PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013618146.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 280aa    MW: 30334.9 Da    PI: 8.8367
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013618146.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-18651147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd++l ++v ++G+++W+ I++ ++ gR++k+c++rw + 
   XP_013618146.1  6 KGPWSPEEDDQLRRLVVKYGPRNWTVISKSIP-GRSGKSCRLRWCNQ 51
                     79******************************.***********985 PP

2Myb_DNA-binding53.94.1e-1760102347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEd  +++a++q+G++ W+tIar ++ gRt++ +k++w++ 
   XP_013618146.1  60 PFSAEEDATIARAHEQFGNK-WATIARLLN-GRTDNAVKNHWNST 102
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.134156IPR017930Myb domain
SuperFamilySSF466894.87E-31399IPR009057Homeodomain-like
SMARTSM007174.1E-17554IPR001005SANT/Myb domain
PfamPF002491.4E-18651IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-24758IPR009057Homeodomain-like
CDDcd001671.55E-16850No hitNo description
SMARTSM007173.5E-1457105IPR001005SANT/Myb domain
PROSITE profilePS5129419.15458107IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2259106IPR009057Homeodomain-like
CDDcd001671.54E-1160103No hitNo description
PfamPF002492.4E-1460102IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MADRIKGPWS PEEDDQLRRL VVKYGPRNWT VISKSIPGRS GKSCRLRWCN QLSPQVEHRP  60
FSAEEDATIA RAHEQFGNKW ATIARLLNGR TDNAVKNHWN STLKRKCGGF DHRYDASAVD  120
HRPAKRSVSD GGPPVANGLY MSPGSPTGSD VSDWSTIPVL PSVGLFRPVP RAGGPLPTET  180
SSSSGDPATS LSLSLPGADA SEESTNINTL SRRQNKNAES FLPFSGGFRG AIEEMGKSFA  240
GDGGSEFMVM VQEMIKAEVR SYMAEMQRDH SGIGGGVFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-3951073105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-3951073105C-Myb DNA-Binding Domain
1msf_C1e-3951073105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013618146.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-155MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D3AYW70.0A0A0D3AYW7_BRAOL; Uncharacterized protein
STRINGscaffold_803378.11e-159(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.11e-156myb domain protein r1